| UAE Jobs |
| Saudi Arabia Jobs |
| Qatar Jobs |
| Dubai Jobs |
| Kuwait Jobs |
| Oman Jobs |
| Bahrain Jobs |
| Jordan Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
FOR OUR UPCOMING BRANCH IN AL SUYOH, SHARJAH Job Title:˙Coffee Barista : As a coffee barista, you will play a crucial role in providing excellent customer service and de...
Senior Projects Manager Applicants must already be located inside the UAE to be considered for this position. Industry: Civil Engineering / Civil / Construction Contracting Work Site: Dubai, UAE S...
Is Responsible for end-to-end implementation of Billing module. He/she must be a graduate with a minimum experience of 5 years in Healthcare RCM, Insurance, and claims workflow with Hospital/Payer/Pro...
Primary Duties & responsibilities include but not limited to:
Priorities and Objectives
Dubai Taxi Driver Job Details: || Company will provide a UAE driving license, RTA permit card, PTA training, E-test, Eye test, RTA medical, CID clearance, Contract, and Police clearance and all this ...
Job Title: Real Estate Agent Company: Propertyana Real Estate LLC Location: Business Bay, Dubai, UAE Job Type: Full-Time, Permanent Commission: Up to 80% We are seeking an experienced, dynamic, a...
The Loom Collection Furniture˙Shop is seeking a passionate and responsible Customer Experience Associate to join our studio location in Dubai Investment Park 1. You will provide exemplary custo...
Painting Foreman for our reputed Abu Dhabi Client Work Location : Offshore Flight ticket : Provided by company Food & Accommodation : Provided by company. Medical Insurance : Provided by company. ...
Offshoreexperience1)Restaurent supervisor 2) Outlet Supervisor 3) Waiter/Waitress 4) Bartenders 5) Lobby Hostess 6) Senior Chef de Partie 7) Restaurant Hostess 8) Commis I 9) Commis II 10) Commis III Location: Abudhabi...
GoodcommunicationskillsClinical Psychologist DOH / HAAD License Minimum of 5-7 Years of experience Maximum Notice Period: 1 Month Salary 20000AED-25000AED Job Location : Abu Dhabi JOB SUMMARY: This positio...
Clinical PsychologistPsychologistDOHHAADDHAMOHDUBAI HEALTH AUTHORITYdepartment of healthMINISTRY OF HEALTHAre you a skilled and customer-oriented driver Do you have a passion for delivering exceptional service and ensuring a seamless experience for our guests If so, we have an exciting opportunity for you...
JOB PURPOSE: Assists and support Executive Director and Directors concerning Government Payment Solutions and liaising with teams towards achieving the required and targeted objectives. Oversees the b...
We are seeking a skilled and experienced Bodyshop Manager to oversee our body shop operations. As a Bodyshop Manager, you will be responsible for managing a team of technicians, ensuring high-quality ...
Job Purpose Compile information and records to draw up purchase orders for procurement of materials and services. Purchase includes equipment, supplies or services necessary for smooth operati...
We are seeking a skilled and dedicated HR Administrator to join our company. As an HR Administrator, you will play a crucial role in ensuring the smooth operation of our HR department. Your primary re...
|| Company will provide a UAE driving license, RTA permit card, PTA training, E-test, Eye test, RTA medical, CID clearance, Contract, and Police clearance and all this cost company will deduct from yo...
-Excellent opportunity for growth and development -Comprehensive salary package -Join a team of world class HR professionals Our client is a complete Government HR support system that provides busine...
KSAdrivinglicenseShawarma Maker Job Location : Saudi Arabia Desired candidate profile : ?Age 21 to 35 years ?Indian experience with English Speaking ?Indian Nationals Benefits provided by company : Accommodation +...
EnglishSpeakingForklift operator who can handle Pallets of Juice Job Location : Riyadh Salary : 1600 SAR Medical Insurance: provide Vacation: yearly Accommodation: Provide Duty time: 8 hours Req...
TransferableIqamaWe currently have an opening for a western experience and qualified Interventional Radiology Consultant to join our Clients Hospital which aims to become the largest and fastest growing provider of he...
InterventionalRadiologyWe currently have an opening for a western experience and qualified Ophthalmology Consultant to join our Clients Hospital which aims to become the largest and fastest growing provider of healthcare ex...
OphthalmologyLobby Hostess For a 5 star Hotel in Dubai Salaries in AED 1,800 Accommodation, Transport, Duty Meals,Health insurance,Visa and Ticket provided by the company Requirements : ? Thai National...
HostessExcellentcustomerserviceGoodcommunicationskillsEstimator Job Location : Abu Dhabi Qualifications: ?Candidates must be a graduate in relevant discipline ?Experience: with minimum of 4 years? experience in Joinery. ?Must be available in UAE for f...
experienceinJoineryTravel Coordinator at Nourbelle Tours, your primary responsibility is to assist clients in planning and organizing their travel experiences. You will be the main point of contact for customers, provid...
Position Overview: The successful candidate will be responsible for promoting and selling a range of banking products to customers, including credit cards, mortgage loans, personal finance sol...
About Company : Dubai based Accounting and Bookkeeping firm˙ Office timings : 9 am to 6pm˙ Location : Bur Dubai, Al Karama, Dubai˙ Position : Corporate Tax Manager˙˙ Salary Range : 10-12 k Dirham ...
QA / QC Inspector for our reputed Abu Dhabi Client Work Location : Offshore Flight ticket : Provided by company Food & Accommodation : Provided by company. Medical Insurance : Provided by company....
OffshoreexperienceTelesales Executive Job Location : UAE Requirements : ?Bachelor?s degree or equivalent. ?Proven telesales or tele calling experience in the BFSI domain. ?Effective communication and people skills. ...
ExperienceinhandlingMicrosoftOfficeToolsandAnalyticaltoolsPosition Title:˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙Public Relations Officer (PRO) Employment Type:˙˙˙˙˙˙˙Full Time Salary:˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙up to 20K AED all inclusive depending on experienc...
Fire Systems Services Technician Job Location : Riyadh Working Time: 9H - 6 days a week Housing: the company provides Transportation: the company provides Insurance: company provide Salary 2,500...
MaintainsandrepairselectroniccontrolpanelsswitchesrelayssignaldevicesmotorsgeneratorsandrelatedequipmentWe are looking for a compassionate Anesthetist to be responsible for administering the appropriate anesthetics before medical procedures. The duties of an Anesthetist include assessing the health of a...
AnesthesiologistPainMedicineRelationship Officer - Credit Cards Sales Job Location : Dubai Requirements: ?Candidates with 1-3 years of sales banking experience in credit cards and personal loans ?Visa Type: Family Spouse Visa...
salesbankingexperienceRecruiting Insurance Coordinator Job Location : Dubai Requirements: ?Need experience ?Immediate joiners...
CoordinatingGoodcommunicationskillsDavidson Management Consultants have been mandated to recruit western trained Nurses for their client in Abu Dhabi which is a multispecialty hospital in Abu Dhabi.We are looking for DOH licensed Nurse...
NursingMonglish Academy is hiring ESL Teachers: 1. Full-time online English teachers (C1 Fluency is a must) 2. Full-time online English trainee teachers (fresh graduates) Who are enthusiastic, positive, c...
NorthBay Solutions is looking for a highly skilled and motivated Lead Software Engineer with solid experience in Machine Learning and Artificial Intelligence domain. The ideal candidate will have expe...
Nisum is a leading global digital commerce firm headquartered in California, with services spanning digital strategy and transformation, insights and analytics, blockchain, business agility, and custo...
As a Direct Sales Associate (DSA) in the banking industry, your primary responsibility will be to promote and sell retail banking products and services directly to customers. You will play a crucial r...
Business Manager | Al Futtaim Automotive | Domasco - Honda Overview of the role:
Assist the Financial Controller in coordination ˙with Senior Accountants for the daily operations ˙of the accounting department including:˙˙
The position: This position offers an excellent opportunity for a qualified and self-driven ?External Auditor?. Your role is crucial to ensure execution of insurance companies audit mandates. We offe...
Manpower Planning and Recruitment/Selection ?
The Story so far: Who we are˙ Huspy is a proptech startup solving two of the biggest challenges in the home buying journey: home financing and home search.˙We are currently operational ...
1. 05+ years of related experience in fire protection system/Knowledgeable on NFPA 70E, NFPA72, fire alarm system, NFPA 2001. 2. Fire suppression system and NFPA 20 fire pump system. 3. Bachelor of E...
firesuppressionsystems safetycodes fireprotection projectmanagement nfpa firecode revit plumbing lifesafetysystems calculationThe Marketing Officer at Windmills will oversee all marketing and promotional activities, collaborating with senior management, business development, and marketing agency to enhance the company?s prof...
Marketing Sales GoodcommunicationskillsClaims Executive due to growth & expansion of our Corporate Client Division Job Location : Dubai Requirements : ?Mandatory requirement is 2 to 3 years of General Insurance (non-Health and non-Life)...
UAEexperience
© 2023 HireeJobsGulf All Rights Reserved