| UAE Jobs |
| Saudi Arabia Jobs |
| Qatar Jobs |
| Dubai Jobs |
| Kuwait Jobs |
| Oman Jobs |
| Bahrain Jobs |
| Jordan Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
HR Coordinator Job Location : UAE Job Requirements: ?Should have minimum 2 years of UAE Experience ?Any Nationals...
UAEexperienceIs Responsible for end-to-end implementation of Billing module. He/she must be a graduate with a minimum experience of 5 years in Healthcare RCM, Insurance, and claims workflow with Hospital/Payer/Pro...
Primary Duties & responsibilities include but not limited to:
Principal Accountabilities The Site Material Coordinator s expected to: ˙
Priorities and Objectives
Priorities and Objectives ?Ensure SAFETY at all times.
Job Title: Sales and Operation Coordinator Main Purpose of Job Role: The ˙Sales ˙& operation ˙Coordinator ˙is ˙responsible ˙for ˙providing ˙sales, ˙marketing, administrative ˙support ˙in ˙add...
Dubai Taxi Driver Job Details: || Company will provide a UAE driving license, RTA permit card, PTA training, E-test, Eye test, RTA medical, CID clearance, Contract, and Police clearance and all this ...
Job Title: Real Estate Agent Company: Propertyana Real Estate LLC Location: Business Bay, Dubai, UAE Job Type: Full-Time, Permanent Commission: Up to 80% We are seeking an experienced, dynamic, a...
The Loom Collection Furniture˙Shop is seeking a passionate and responsible Customer Experience Associate to join our studio location in Dubai Investment Park 1. You will provide exemplary custo...
Painting Foreman for our reputed Abu Dhabi Client Work Location : Offshore Flight ticket : Provided by company Food & Accommodation : Provided by company. Medical Insurance : Provided by company. ...
Offshoreexperience1)Restaurent supervisor 2) Outlet Supervisor 3) Waiter/Waitress 4) Bartenders 5) Lobby Hostess 6) Senior Chef de Partie 7) Restaurant Hostess 8) Commis I 9) Commis II 10) Commis III Location: Abudhabi...
GoodcommunicationskillsClinical Psychologist DOH / HAAD License Minimum of 5-7 Years of experience Maximum Notice Period: 1 Month Salary 20000AED-25000AED Job Location : Abu Dhabi JOB SUMMARY: This positio...
Clinical PsychologistPsychologistDOHHAADDHAMOHDUBAI HEALTH AUTHORITYdepartment of healthMINISTRY OF HEALTHAre you a skilled and customer-oriented driver Do you have a passion for delivering exceptional service and ensuring a seamless experience for our guests If so, we have an exciting opportunity for you...
Assist in production activity control to meet business and financial objectives. Work with Managers to plan and manage production tasks to improve runtime. Review production plans to identify and ...
Oil And GasFabricationPressure VesselsJOB PURPOSE: Assists and support Executive Director and Directors concerning Government Payment Solutions and liaising with teams towards achieving the required and targeted objectives. Oversees the b...
We are seeking a skilled and experienced Bodyshop Manager to oversee our body shop operations. As a Bodyshop Manager, you will be responsible for managing a team of technicians, ensuring high-quality ...
Job Purpose Compile information and records to draw up purchase orders for procurement of materials and services. Purchase includes equipment, supplies or services necessary for smooth operati...
We are looking for a Logistics Coordinator.˙receptiontrd(at)milliacosmetics(dot)com RESPONSIBILITIES: Provide assistance to the Procurement Director. Communicate with suppliers regarding cargo/orde...
We are seeking a skilled and dedicated HR Administrator to join our company. As an HR Administrator, you will play a crucial role in ensuring the smooth operation of our HR department. Your primary re...
II. POSITION SUMMARY The successful candidate will: Handle and facilitate the Interface Coordination between various Discipline for the smooth execution of Projects. The IGCC Facilitie...
|| Company will provide a UAE driving license, RTA permit card, PTA training, E-test, Eye test, RTA medical, CID clearance, Contract, and Police clearance and all this cost company will deduct from yo...
Project Coordinator Job Location : Riyadh Requirements: ?5 years experience and civil background...
civilbackground-Excellent opportunity for growth and development -Comprehensive salary package -Join a team of world class HR professionals Our client is a complete Government HR support system that provides busine...
KSAdrivinglicenseShawarma Maker Job Location : Saudi Arabia Desired candidate profile : ?Age 21 to 35 years ?Indian experience with English Speaking ?Indian Nationals Benefits provided by company : Accommodation +...
EnglishSpeakingForklift operator who can handle Pallets of Juice Job Location : Riyadh Salary : 1600 SAR Medical Insurance: provide Vacation: yearly Accommodation: Provide Duty time: 8 hours Req...
TransferableIqamaWe currently have an opening for a western experience and qualified Interventional Radiology Consultant to join our Clients Hospital which aims to become the largest and fastest growing provider of he...
InterventionalRadiologyWe currently have an opening for a western experience and qualified Ophthalmology Consultant to join our Clients Hospital which aims to become the largest and fastest growing provider of healthcare ex...
OphthalmologyFM Procurement Coordinator Job Location: Qatar Duration: 3 months Job Requirements: ?Any degree/ diploma (Technical education preferred) ?Minimum 5 years of Gulf experience is must ?Immediately av...
ProcurementCoordinatorCoordinationFacilitiesManagementPurchaseGoodCommunicationSkillsLobby Hostess For a 5 star Hotel in Dubai Salaries in AED 1,800 Accommodation, Transport, Duty Meals,Health insurance,Visa and Ticket provided by the company Requirements : ? Thai National...
HostessExcellentcustomerserviceGoodcommunicationskillsEstimator Job Location : Abu Dhabi Qualifications: ?Candidates must be a graduate in relevant discipline ?Experience: with minimum of 4 years? experience in Joinery. ?Must be available in UAE for f...
experienceinJoineryPurchase Coordinator Job Location : UAE Requirements: ?Should have experience as Purchase Coordinator ?Any Nationals...
Purchaseexperience
Travel Coordinator at Nourbelle Tours, your primary responsibility is to assist clients in planning and organizing their travel experiences. You will be the main point of contact for customers, provid...
Visual Assistant/ Visual Merchandiser | Retail | Marks & Spencer | 360 | KUWAIT Overview of the role: ˙ Reporting to the Area Visual Coordinator, your role will be to implement and ma...
Position Overview: The successful candidate will be responsible for promoting and selling a range of banking products to customers, including credit cards, mortgage loans, personal finance sol...
Responsibilities:
About Company : Dubai based Accounting and Bookkeeping firm˙ Office timings : 9 am to 6pm˙ Location : Bur Dubai, Al Karama, Dubai˙ Position : Corporate Tax Manager˙˙ Salary Range : 10-12 k Dirham ...
QA / QC Inspector for our reputed Abu Dhabi Client Work Location : Offshore Flight ticket : Provided by company Food & Accommodation : Provided by company. Medical Insurance : Provided by company....
OffshoreexperienceTelesales Executive Job Location : UAE Requirements : ?Bachelor?s degree or equivalent. ?Proven telesales or tele calling experience in the BFSI domain. ?Effective communication and people skills. ...
ExperienceinhandlingMicrosoftOfficeToolsandAnalyticaltoolsPosition Title:˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙Public Relations Officer (PRO) Employment Type:˙˙˙˙˙˙˙Full Time Salary:˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙˙up to 20K AED all inclusive depending on experienc...
Fire Systems Services Technician Job Location : Riyadh Working Time: 9H - 6 days a week Housing: the company provides Transportation: the company provides Insurance: company provide Salary 2,500...
MaintainsandrepairselectroniccontrolpanelsswitchesrelayssignaldevicesmotorsgeneratorsandrelatedequipmentSenior Projects Coordinator - Civil / Architect Job Location : Riyadh Job Summary : The project Coordinator is a link between the Project Management Teams and various departments in the Head Office...
TranslatableIqamaLooking for an administrative coordinator having technical knowledge on HVAC system maintenance i.e PACUs, FCUs, Concealed or DX units and Chillers, ?etc. To perform the following duties:- 1.Receiving...
CoordinationWe are looking for a compassionate Anesthetist to be responsible for administering the appropriate anesthetics before medical procedures. The duties of an Anesthetist include assessing the health of a...
AnesthesiologistPainMedicineProject Coordinator Job Location : Dubai Requirements: ?Bachelor?s degree holder ?Have an experience in an exhibition industry ?Good working knowledge of Microsoft Office (Excel, Word, Outlook), ?B...
experienceinanexhibitionindustryRelationship Officer - Credit Cards Sales Job Location : Dubai Requirements: ?Candidates with 1-3 years of sales banking experience in credit cards and personal loans ?Visa Type: Family Spouse Visa...
salesbankingexperienceRecruiting Insurance Coordinator Job Location : Dubai Requirements: ?Need experience ?Immediate joiners...
CoordinatingGoodcommunicationskills
© 2023 HireeJobsGulf All Rights Reserved