| UAE Jobs |
| Saudi Arabia Jobs |
| Qatar Jobs |
| Dubai Jobs |
| Kuwait Jobs |
| Oman Jobs |
| Bahrain Jobs |
| Jordan Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
QC Technician Job Location: Kuwait Salary: KD 350/- Benefits: Attractive Salary + Free Food, Accommodation & Transportation Job Requirements: ?Ex-Equate / Kuwait experience is a must ?Equate appr...
QualityControlAssuranceTechnicianEx-EquateGoodCommunicationSkillsFemale Indian Secretary Job Location : Salmiya Qualifications: ?Computer science / Web Designing background required for a Manufacturing company in Sabhan. Well experienced in MSOffice, routine cor...
Article18or22Logistics Manager Job Location : Kuwait City Requirements and Qualifications: ?High school diploma or degree certificate ?Basic computer skills ?Organizational and time management skills ?Valid Kuw...
ManagingGoodcommunicationskillsAccountant Job Location : UAE : ?Oversee the duties of the accounting team. ?Implement accounting systems and processes. ?Reconcile income statements. ?Prepare monthly financial reports. ?Control t...
MicrosoftExcelandotherfinancialoraccountingsoftwareRadiologist Job Location : UAE Responsibilities: ?Evaluating patients? medical histories to ensure the various medical imaging procedures will not harm them. ?Suggesting alternative medical imaging...
RadiologyEEG Technician Job Location : UAE Responsibilities: ?Perform routine and complex EEG tests on pediatric and adult patients according to established protocols and physician orders. ?Prepare patients...
knowledgeofEEGequipmentoperationelectrodeplacementandsignalacquisitiontechniquesTechnical Office Engineer (Bidding Pricing Proposals) - Sheet Metal
Technical Office Engineer (Bidding Pricing Proposals) - Sheet Metal
Hiring Telecom Field Technicians with:
Role purpose: Work in the Customer Care function for˙ to really deliver an awesome customer experience. The role is responsible for handling multiple customer care tasks and activities including but...
Responsibilities
National Technicians | Al Futtaim Automotive | FAMCO Overview of the role: To carry out accurate advanced diagnosis and effective complex repairs on vehicles, machinery and equipment, ...
Note: You Must be available in the UAE to Apply. Duties & Responsibilities: ú Accurately enter and update various types of data, including alphanumeric information, numerical da...
Tasks vary depending on whether youre working in live or recorded sound, and according to the size of the team, but generally youll be expected to:
Operates and installs computing equipment related to infrastructure and applications including severs, storage, network telecom and software. Perform daily inspections and reporting of all critical i...
Tasks vary depending on whether youre working in live or recorded sound, and according to the size of the team, but generally youll be expected to:
Forklift Technician | Al Futtaim Automotive | ToyotaOverview of the role: Forklift Technicians should ensure being up-to-date with technical aspects of the product/vehicle and to be able to fi...
Valve Technicians Job Location : Qatar Responsibilities: ?Possess knowledge of hand tools, equipment, and testing devices used in valve maintenance and repair. ?Familiarity with API 6A products. ?U...
FamiliaritywithAPI6AproductsNair Systems is currently looking for Application Support Engineer our Qatar operations with the following terms & conditions. JOB PURPOSE/SUMMARY Application management for Information Technology sy...
L2andL3supportMerchantacquiringpaymentgatewaysRole & Responsibilities As a Sales Associate, you will be responsible for contacting real estate brokers and freelancers and introducing our paid advertising feature to them. Many of these people wil...
SalesAC Technician Job Location : UAE Requirements : ?Should have experience as AC Technician ?Any Nationals...
MaintenanceRepairAnaesthesia Technician Job Location : UAE Job Details : ?Candidates with relevant Degree/Diploma or (Equivalent) ?Candidates with prior working experience in a similar role...
HospitalexperienceGraphic Designer Job Location : UAE Job Summary : ?Required to create visual concepts, using computer software to communicate ideas that inspire, inform, or captivate consumers. ?Prepare rough draf...
PhotoshopIllustratorInDesignTechnician FMC AC & Mechanical Job Location : UAE Requirements : ?Diploma / ITI in Mechanical Engineering or equivalent ?Valid UAE Driving license ?4 ? 5 years in the field of Engineering services ...
UAEdrivinglicenseTechnician - Instrumentation for a paper Manufacturing Industry Job Location : Abu Dhabi Requirements : ?Immediate joining ?Need Experience...
TechnicianMaintenanceRequired urgently Service Advisor 1. Degree / Diploma in Automobile Engineering 2. 3-5 years experience in dealer or high end vehicles 3. Good English communication skill required 4. Greet custome...
CustomerServiceAs a Workshop Senior Technician your role includes supervising the technicians work and review the results to continuously improve performance, and enhance customer relationships, while ensuring that ...
Field Service Technician Job Location : Riyadh Requirements: ?Minimum of 3 years of experience in banking related products or electronics/hardware repairing. ?Good English, speaking & Writing, and ...
TechnicianMaintenanceFire Systems Services Technician Job Location : Riyadh Working Time: 9H - 6 days a week Housing: the company provides Transportation: the company provides Insurance: company provide Salary 2,500...
MaintainsandrepairselectroniccontrolpanelsswitchesrelayssignaldevicesmotorsgeneratorsandrelatedequipmentInternal Auditor Job Location : Riyadh Responsibilities : ? Perform and control the full audit cycle including risk management and control management over operations? effectiveness, financial relia...
ProvenknowledgeofauditingstandardsandprocedureslawsrulesandregulationsTechnician ? Electrical Job Location : UAE Requirements : ?Should have experience as Electrical Technician ?Any Nationals...
MaintenanceRepairSales / Leasing Property Consultant Job Location : UAE Requirements: ?The candidate must be in UAE ?Having a Valid UAE Driving License and own car is an advantage. ?Previous experience in Real Esta...
UAEdrivinglicenseTechnician Automotive Subsidiary: EMC MB Cars/ EMC Daimler Commercial Vehicles/ Western Motors/ Eastern Motors/ Central Motors & Equipment (Abu Dhabi/ Dubai). Job Purpose: ?Perform quality servicin...
Experienceinpremium/luxurycarbrandWe are looking for a kitchen equipment technician for our company who can repair the equipment, fix the equipment, identify the issues in the equipment and install kitchen hot and cold equipment as we...
ExperienceinHotelComputer Teacher Job Location : UAE Job Details : ?Bachelors in computing with experience in similar field ?Any Nationals...
TeachingexperienceNorthBay Solutions is looking for a highly skilled and motivated Lead Software Engineer with solid experience in Machine Learning and Artificial Intelligence domain. The ideal candidate will have expe...
Nisum is a leading global digital commerce firm headquartered in California, with services spanning digital strategy and transformation, insights and analytics, blockchain, business agility, and custo...
Overview:??˙ Enterprise64 is a U.S.-based technology company that creates digital solutions for startups to Fortune 500 companies in the United States, Europe and United Arab Emirate...
Overview Enterprise64 is a U.S.-based technology company that creates digital solutions for startups to Fortune 500 companies in the United States, Europe, and United Arab Emirates. ...
Every great story has a new beginning, and yours starts here. Welcome to Warner Bros. Discovery? the stuff dreams are made of. Who We Are? When we say, ?the stuf...
Cssd Technician - Licensed by Commission for Health Specialties
We are currently looking for Administrative Assistant for our office, preferably Female. Interested candidate with relevant receptionist, data entry & administrative experience can apply. Candi...
We are seeking to hire an AC Technician.
The post holder will be responsible for tyre related services including tyre inspection, replacement, alignment and balancing for a wide range of vehicles. The role may be based in a workshop or outdo...
ELEVATOR MAINTENANCE TECHNICIAN i. Candidates must have minimum 8 years of experience in maintenance of Elevator. ii. Salary 2000-3000SAR & Duty 8 hours + Overtime Contact on: 7506229873/9892304135 ...
Technician MaintenanceMillwright Technicians Job Location : Jubail Duration 3 months extendable Requirements : ? Need experience Documents - Chamber, Valid Iqama and Muqeem must...
Technician MaintenanceMechanical Technician Job Location : Saudi Arabia Requirements : ? Qualification: ITI/ Diploma ? Candidate should have experience in Facility Maintenance (O&M), (I, e. Hotel, Mall, Airport, High ri...
GCCexperience
© 2023 HireeJobsGulf All Rights Reserved